General Information

  • ID:  hor003539
  • Uniprot ID:  A0A6I8T824??94-102)
  • Protein name:  CAPA-Periviscerokinin-2
  • Gene name:  5566490
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QGLVPFPRV
  • Length:  9(94-102)
  • Propeptide:  MQQVTQFKTLAYVSLVFVVLSAVKFCRADASDLDSVSEGRHKRGPTVGLFAFPRVGRSDPDLLEWSDAAAVAAALPLELADDYEDYPIREAKRQGLVPFPRVGRSGMNAARFYWPKTMMPQQQKRAGNSGANSGMWFGPRLGKRANAASTEIKGTEVYTPRLGRNSERPQIGESGDLNARSSSRSKLEDFERLFRSSDN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6I8T824-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003539_AF2.pdbhor003539_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 115509 Formula: C48H77N13O11
Absent amino acids: ACDEHIKMNSTWY Common amino acids: PV
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 37.78 Boman Index: -354
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 107.78
Instability Index: 6471.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti